Q8WWY6 MB3L1_HUMAN
Gene name: MBD3L1
Protein name: Methyl-CpG-binding domain protein 3-like 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IV35 | WDR49 | 0.90934 | |
| 2 | Q9NWS6 | FAM118A | 0.89908 | |
| 3 | Q8IYD9 | LAS2 | 0.7483 | cell population proliferation GO:0008283 |
| 4 | Q96MH7 | C5orf34 | 0.7193 | |
| 5 | A2RTY3 | HEATR9 | 0.7104 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 |
| 6 | Q9UN76 | SLC6A14 | 0.65212 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | A6NN14 | ZNF729 | 0.64404 | |
| 8 | Q9Y3N9 | OR2W1 | 0.643 | |
| 9 | Q9Y6A9 | SPCS1 | 0.643 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 ... |
| 10 | Q8TD20 | SLC2A12 | 0.60263 | transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSY STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: DDDDD...DDDDDDD.....................D.DDD..D.DDD.DDDDDD............................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDD................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD..............D........DDDDDDDDDD............................................. CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KssqrKqrdcvnqcKsK RICH_[CK]: KssqrKqrdCvnqCKsK RICH_[CQ]: QrkQrdCvnQC
120 140 160 180 AA: TGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEKR STMI: DO_DISOPRED3: .............DDDDDDDDDDDD.......................................................DDDDDDDDDDDDDD DO_IUPRED2A: .................................................................................DDDDDDDDDDDDD DO_SPOTD: ..DDDDDDDDDDDDDD.............................................................DDDDDDDDDDDDDDDDD CONSENSUS: .............DDD................................................................DDDDDDDDDDDDDD CONSENSUS_MOBI: ..............................................................................................