Q8WXF3 REL3_HUMAN

Gene name: RLN3
Protein name: Relaxin-3

List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q06033 ITIH3 0.74448 small molecule metabolic process GO:0044281
transport GO:0006810
vesicle-mediated transport GO:0016192
2 P05198 EIF2S1 0.72854 biosynthetic process GO:0009058
cell death GO:0008219
cellular component assembly GO:0022607
...
3 O75794 CDC123 0.7235 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
4 Q6NVV0 MKRN9P 0.71707
5 Q5VT99 LRRC38 0.71527 transmembrane transport GO:0055085
transport GO:0006810
6 Q9UBS8 RNF14 0.71327 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
7 Q2NL67 PARP6 0.6927 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
8 Q96ME1 FBXL18 0.68599 catabolic process GO:0009056
cell cycle GO:0007049
cellular protein modification process GO:0006464
...
9 Q7Z6K5 ARPIN 0.66843 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
10 Q9C0I1 MTMR12 0.66264 biosynthetic process GO:0009058
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAF
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSS                                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDD................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .............................................................................DD.....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                        .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                   ...........................................................................
RICH_[AD]:                                                                      DilAheAmgDtfpDADADeDslA                      
RICH_[AE]:                                                                                    AdAdEdslAgEldEAmgssE           
RICH_[D]:                                                                       DilaheamgDtfpDaDaDeDslagelD                  
RICH_[W]:                                                                                                         Wlaltkspqaf
RICH_[DE]:                                                                                     DaDEDslagElDEamgssE           
RICH_[EL]:                                                                                        EdsLagELdEamgssEwLaL       
RICH_fLPS_[D]:                                                                  DilaheamgDtfpDaDaDeDslagelD                  

                                          120                 140                  
AA:                      YRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC
STMI:                                                              
DO_DISOPRED3:            DDDDDDDDDDDDD.............................
DO_IUPRED2A:             ..........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS:               DDDDDDDDDDDDD.............................
CONSENSUS_MOBI:          ..........................................
RICH_[W]:                yrgrpsW