Q8WXF5 CRGN_HUMAN
Gene name: CRYGN
Protein name: Gamma-crystallin N
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- nervous system process GO:0050877
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IWA4 | MFN1 | 0.89153 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 membrane organization GO:0061024 ... |
| 2 | Q02817 | MUC2 | 0.86754 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 homeostatic process GO:0042592 ... |
| 3 | Q7L9B9 | EEPD1 | 0.85035 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 ... |
| 4 | Q96D59 | RNF183 | 0.82278 | cell death GO:0008219 cellular protein modification process GO:0006464 response to stress GO:0006950 ... |
| 5 | Q496F6 | CD300E | 0.80114 | immune system process GO:0002376 response to stress GO:0006950 |
| 6 | Q9HCI5 | MAGEE1 | 0.78384 | |
| 7 | Q9HC84 | MUC5B | 0.77247 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 8 | Q04900 | CD164 | 0.74077 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell population proliferation GO:0008283 ... |
| 9 | P98088 | MUC5AC | 0.7342 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 10 | Q9BXF9 | TEKT3 | 0.72793 | cellular component assembly GO:0022607 reproduction GO:0000003 |
20 40 60 80 100 AA: MAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRWNSHSDHMGSCRPVGMHGEHFRLEIF STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDDD................................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: EGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL STMI: DO_DISOPRED3: ................................................................................DD DO_IUPRED2A: ......................................................D.DDDDDDDDDDDDDDDDDDDDDDDD.. DO_SPOTD: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[PT]: PeeaTTkPaTTqPPflT RICH_[T]: TTkpaTTqppflT RICH_MOBI_[T]: TTkpaTTqppflT