Q8WZ82 OVCA2_HUMAN
Gene name: OVCA2
Protein name: Esterase OVCA2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9P2E5 | CHPF2 | 0.91782 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 2 | Q969S8 | HDAC10 | 0.91187 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | Q9GZM8 | NDEL1 | 0.87589 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 4 | Q9Y2B5 | VPS9D1 | 0.87351 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 5 | P19544 | WT1 | 0.83089 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | P41235 | HNF4A | 0.80084 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | Q92968 | PEX13 | 0.78651 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 8 | Q8WWR8 | NEU4 | 0.77159 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | P42768 | WAS | 0.76996 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell morphogenesis GO:0000902 ... |
| 10 | Q02833 | RASSF7 | 0.7673 | cell death GO:0008219 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
20 40 60 80 100 AA: MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLG STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: ...........................................DDDDDDDDDDDDDDDDDDDDD.................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDD................................................................................................. CONSENSUS_MOBI: ...........................................DDDDDDDDDDDDDDDDDDDDDDDDD................................ RICH_MOBI_[P]: PhPvPdPPgPegarsdfgscPP RICH_MOBI_[GP]: GPhPvPdPPGPeGarsdfG RICH_fLPS_MOBI_[P]: PhPvPdPPgP
120 140 160 180 200 AA: MVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: THSGGHFIPAAAPQRQAYLKFLDQFAE STMI: DO_DISOPRED3: ........................... DO_IUPRED2A: ........................... DO_SPOTD: ........................... CONSENSUS: ........................... CONSENSUS_MOBI: ...........................