Q92847 GHSR_HUMAN
Gene name: GHSR
Protein name: Growth hormone secretagogue receptor type 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- growth GO:0040007
- nervous system process GO:0050877
- protein transport GO:0015031
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O75448 | MED24 | 0.72598 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | P42892 | ECE1 | 0.67337 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q96BR1 | SGK3 | 0.65292 | biosynthetic process GO:0009058 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 4 | Q96KP1 | EXOC2 | 0.65173 | biological process involved in symbiotic interaction GO:0044403 protein transport GO:0015031 transport GO:0006810 ... |
| 5 | O00292 | LEFTY2 | 0.57743 | anatomical structure development GO:0048856 cellular protein modification process GO:0006464 signal transduction GO:0007165 ... |
| 6 | Q8WVF1 | OSCP1 | 0.54847 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | O14662 | STX16 | 0.5475 | membrane organization GO:0061024 protein transport GO:0015031 transport GO:0006810 ... |
| 8 | P32302 | CXCR5 | 0.54658 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell division GO:0051301 ... |
| 9 | Q9Y216 | MTMR7 | 0.54438 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 ... |
| 10 | O14863 | SLC30A4 | 0.53962 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDL STMI: MMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_IUPRED2A: D................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...... ...... .... CONSENSUS_MOBI: ........................................ ...... .... RICH_[D]: DlDwDaspgnDslgD RICH_[W]: WnatpseepgfnltladldW RICH_[DL]: LtLaDLDwDaspgnDsLgDeL
120 140 160 180 200 AA: VRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP STMI: MMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ................. ....................... ................. CONSENSUS_MOBI: ................. ....................... .................
220 240 260 280 300 AA: TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI STMI: MMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ............................................D.DDDDDDDD..DD.......D...D.............................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: .........................................DDDDDDDDDDDDDDDDDDDDD...................................... CONSENSUS: ........... .........DDDDDDDDDDDDDD..... ............... CONSENSUS_MOBI: ........... ............................ ...............
320 340 360 AA: SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWTESSINT STMI: MMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .........................................DDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................................. DO_SPOTD: ..........................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .. ................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .. ........................................ RICH_[S]: SqrklStlkdeSSrawteSS