Q92934 BAD_HUMAN

Gene name: BAD
Protein name: Bcl2-associated agonist of cell death

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- protein maturation GO:0051604
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P20930 FLG 0.623 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
2 Q658K8 EEF1DP3 0.61062 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
3 Q5D862 FLG2 0.60175 anatomical structure development GO:0048856
cell adhesion GO:0007155
homeostatic process GO:0042592
...
4 Q7Z2V1 C16orf82 0.5842
5 A6NFC9 OR2W5P 0.56331
6 Q13671 RIN1 0.56009 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
7 Q86YZ3 HRNR 0.5554 anatomical structure development GO:0048856
cell differentiation GO:0030154
homeostatic process GO:0042592
...
8 Q6ZN18 AEBP2 0.55299 chromosome organization GO:0051276
9 Q8WYQ9 ZCCHC14 0.55251
10 Q96M63 CCDC114 0.54879 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003

                                           20                  40                  60                  80                 100
AA:                      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
STMI:                                                                                                                        
DO_DISOPRED3:            .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[E]:                     EfEpsEqEdsssaE                                                                                 
RICH_[G]:                                    GlGpspaGdGpsGsG                                                                 
RICH_[H]:                                                    HHrqapgllwdasH         HHggagaveirsrH                           
RICH_[Q]:                                                       QapgllwdashQQeQ                                              
RICH_[S]:                              SSSaerglgpSpagdgpSgS                      SSShhggagaveirSrhSS                         
RICH_[EF]:                FqipEFEpsE                                                                                         
RICH_[EG]:                                                                                             GtEddEGmGEEpspfrG     
RICH_[ES]:                      EpSEqEdSSS                                                                                   
RICH_[GP]:                                     GPsPaGdGPsGsGkhhrqaPG                                                         
RICH_[GS]:                             SSSaerGlGpSpaGdGpSGS                                                                  
RICH_[HQ]:                                                    HrQapgllwdasHQQ                                                
RICH_MOBI_[E]:                EfEpsEqEdsssaE                                                                                 
RICH_MOBI_[G]:                               GlGpspaGdGpsGsG                                                                 
RICH_MOBI_[H]:                                               HHrqapgllwdasH         HHggagaveirsrH                           
RICH_MOBI_[Q]:                                                  QapgllwdashQQeQ                                              
RICH_MOBI_[EF]:           FqipEFEpsEqEdsssaE                                                                                 
RICH_MOBI_[EG]:                                                                                        GtEddEGmGEEpspfrG     
RICH_MOBI_[GS]:                        SSSaerGlGpSpaGdGpSGS                                                                  
RICH_MOBI_[HQ]:                                               HrQapgllwdasHQQ                                                

                                          120                 140                 160            
AA:                      PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
STMI:                                                                                        
DO_DISOPRED3:            DDDD.........D........DDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDD...DDD.DDDDDDDDDDDDDDDDDDDDDDDDD.............DD.DDDDDDDD
DO_SPOTD:                ................................DDDD.......................DDDDDDDDD
CONSENSUS:               DDDD..................DDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDD
CONSENSUS_MOBI:          DD........................DDDDDDDDDDDDDDDDDDD.......................