Q93062 RBPMS_HUMAN
Gene name: RBPMS
Protein name: RNA-binding protein with multiple splicing
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96P16 | RPRD1A | 0.76491 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 2 | Q9H0H0 | INTS2 | 0.76491 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q8TE73 | DNAH5 | 0.69653 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 4 | Q8N8Q9 | NIPA2 | 0.69588 | transport GO:0006810 |
| 5 | Q5S007 | LRRK2 | 0.6911 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | P20382 | PMCH | 0.66535 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 7 | Q9BZW2 | SLC13A1 | 0.64927 | transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | Q9ULI1 | NWD2 | 0.64414 | |
| 9 | Q8NAB2 | KBTBD3 | 0.64414 | |
| 10 | Q99570 | PIK3R4 | 0.60629 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD.D........................................................D..DD................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[N]: NNggkaekeNtpseaN RICH_[EN]: NNggkaEkENtpsEaNlqE
120 140 160 180 AA: ANTKMAKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC STMI: DO_DISOPRED3: .....DDDDDDDDDDDDDDDDDDDDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD......... DO_IUPRED2A: ......DDDDDDDDDDDD..DDDD...........................................................D......D..... DO_SPOTD: ...DDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: .....DDDDDDDDDDDDDDDDDDD...........................................................D............ CONSENSUS_MOBI: ................................................................................................