Q969Q0 RL36L_HUMAN
Gene name: RPL36AL
Protein name: 60S ribosomal protein L36a-like
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96H35 | RBM18 | 0.67472 | |
| 2 | Q8TE60 | ADAMTS18 | 0.62789 | anatomical structure development GO:0048856 cell adhesion GO:0007155 response to stress GO:0006950 |
| 3 | Q15415 | RBMY1F | 0.60877 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 reproduction GO:0000003 |
| 4 | A2AJT9 | BCLAF3 | 0.59922 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | P83881 | RPL36A | 0.59589 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | P0C7P1 | RBMY1D | 0.59526 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 7 | A6NEQ0 | RBMY1E | 0.59454 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 8 | P0DJD3 | RBMY1A1 | 0.59392 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 9 | P0DJD4 | RBMY1C | 0.59299 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 10 | A6NDE4 | RBMY1B | 0.58577 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
20 40 60 80 100 AA: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRK STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: D..........DD.D.......D..DDDDD...DDDDDDDDDDDDDDDDDDDDDDD..D......................................... DO_SPOTD: DDDDDDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................DDDDD CONSENSUS: D..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................... CONSENSUS_MOBI: .........................DDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................... RICH_[RY]: YaqgRRRYdRkqsgYggqtkpifR RICH_[K]: KqsgyggqtKpifrKK RICH_[R]: RRRydRkqsgyggqtkpifR RICH_[Y]: YaqgrrrYdrkqsgY RICH_[GR]: GRRRydRkqsGyGG RICH_[GY]: YaqGrrrYdrkqsGYGG RICH_[KY]: YdrKqsgYggqtKpifrKK RICH_fLPS_[Y]: YaqgrrrYdrkqsgY RICH_MOBI_[RY]: YkkgkdslYaqgRRRYdRkqsgY RICH_MOBI_[K]: KKgKdslyaqgrrrydrK RICH_MOBI_[Y]: YkkgkdslYaqgrrrYdrkqsgY RICH_MOBI_[GR]: GRRRydRkqsGyGG RICH_MOBI_[GY]: YaqGrrrYdrkqsGYGG RICH_MOBI_[KR]: KKgKdslyaqgRRRydRK RICH_MOBI_[KY]: YKKgKdslYaqgrrrYdrK RICH_fLPS_MOBI_[Y]: YkkgkdslYaqgrrrYdrkqsgY
AA: GQVIQF STMI: DO_DISOPRED3: ..D... DO_IUPRED2A: ...D.. DO_SPOTD: DDDDDD CONSENSUS: ..DD.. CONSENSUS_MOBI: ......