Q969W0 SPTSA_HUMAN
Gene name: SPTSSA
Protein name: Serine palmitoyltransferase small subunit A
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 60 AA: MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIVQ STMI: MMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DD..................................................................... DO_IUPRED2A: ....................................................................... DO_SPOTD: DDDD................................................................... CONSENSUS: DD.......... ..... .............. CONSENSUS_MOBI: ............ ..... ..............