Q96A57 TM230_HUMAN

Gene name: TMEM230
Protein name: Transmembrane protein 230

List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                 100
AA:                      MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIA
STMI:                                                                 MMMMMMMMMMMMMMMMMMMMM            MMMMMMMMMMMMMMMMMMMMM 
DO_DISOPRED3:            DDDDDDDDDDDDDD......................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD.................................
CONSENSUS:               DDDDDDDDDDDDDD...............................                     ............                     .
CONSENSUS_MOBI:          .............................................                     ............                     .