Q96B49 TOM6_HUMAN
Gene name: TOMM6
Protein name: Mitochondrial import receptor subunit TOM6 homolog
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96MU8 | KREMEN1 | 0.72892 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 2 | P52272 | HNRNPM | 0.60748 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 3 | P52306 | RAP1GDS1 | 0.59481 | |
| 4 | Q9BSJ2 | TUBGCP2 | 0.50816 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 5 | Q99436 | PSMB7 | 0.50637 | |
| 6 | Q96I51 | RCC1L | 0.48879 | |
| 7 | Q12860 | CNTN1 | 0.48507 | |
| 8 | Q5VVH5 | IRAK1BP1 | 0.45063 | immune system process GO:0002376 signal transduction GO:0007165 |
| 9 | Q15004 | PCLAF | 0.43397 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q15691 | MAPRE1 | 0.42149 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
20 40 60 AA: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD.......................................................DD DO_IUPRED2A: .......DD.DDDDDDD......................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDD................................................DDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDD.......................................................DD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD.................................................... RICH_MOBI_[AV]: AsstVpVsAA