Q96BI3 APH1A_HUMAN
Gene name: APH1A
Protein name: Gamma-secretase subunit APH-1A
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P56706 | WNT7B | 0.99842 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q4AC99 | ACCSL | 0.95416 | biosynthetic process GO:0009058 |
| 3 | Q96ID5 | IGSF21 | 0.83205 | |
| 4 | Q9Y6Z4 | KIF25-AS1 | 0.83205 | |
| 5 | Q96SQ5 | ZNF587 | 0.80248 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | A1IGU5 | ARHGEF37 | 0.80224 | |
| 7 | Q8TAU3 | ZNF417 | 0.80088 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | P20800 | EDN2 | 0.7841 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 9 | Q9Y3Z3 | SAMHD1 | 0.76362 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 10 | Q06546 | GABPA | 0.75297 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEG STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDD.D..DD........................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: .D.................................................................................................. CONSENSUS: .D ........ ................ ........... CONSENSUS_MOBI: D. ........ ................ ...........
120 140 160 180 200 AA: LASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLT STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................. ................... ....... CONSENSUS_MOBI: .................. ................... .......
220 240 260 AA: SGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED STMI: MMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..............................................................DDD DO_IUPRED2A: ................................................................. DO_SPOTD: ..............................................................DDD CONSENSUS: ...... ............................DDD CONSENSUS_MOBI: ...... ..........DDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[RV]: RRqedsRVmV RICH_MOBI_[R]: RRqedsRvmvysalR