Q96CS7 PKHB2_HUMAN
Gene name: PLEKHB2
Protein name: Pleckstrin homology domain-containing family B member 2
List of terms from Generic GO subset, which this protein is a part of:
- cell differentiation GO:0030154
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P46094 | XCR1 | 0.77111 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 2 | P56746 | CLDN15 | 0.72424 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 3 | Q99999 | GAL3ST1 | 0.72399 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | P17482 | HOXB9 | 0.7205 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q5H8A4 | PIGG | 0.71399 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 6 | Q01892 | SPIB | 0.68616 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | P55771 | PAX9 | 0.65917 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | O00560 | SDCBP | 0.65439 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 9 | Q93038 | TNFRSF25 | 0.65253 | cell death GO:0008219 signal transduction GO:0007165 |
| 10 | Q99581 | FEV | 0.65239 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAW STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ...........................................................D.DDDDDDD................................ DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: KFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSD STMI: DO_DISOPRED3: ..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......... DO_IUPRED2A: .............................DDD.........................................................DD......... DO_SPOTD: ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: ..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................D.......... CONSENSUS_MOBI: .................................................................................................... RICH_[PY]: PPPYtaYaaPaP RICH_[AP]: PPPytAyAAPAPeqA RICH_[AY]: YtAYAApApeqA RICH_[A]: AyAApApeqA
220 AA: LALGMLAGAATGMALGSLFWVF STMI: DO_DISOPRED3: ...................... DO_IUPRED2A: ...................... DO_SPOTD: ...............DDDDDDD CONSENSUS: ...................... CONSENSUS_MOBI: ......................