Q96D98 EID2B_HUMAN

Gene name: EID2B
Protein name: EP300-interacting inhibitor of differentiation 2B

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00499 BIN1 0.53783 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
...
2 P0C7T5 ATXN1L 0.51861 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
3 Q9BYN7 ZNF341 0.50527 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q96JE9 MAP6 0.50428 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
5 Q32MK0 MYLK3 0.50184 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 Q9P2E8 MARCHF4 0.49735
7 Q86VE0 MYPOP 0.49612
8 Q9UJ55 MAGEL2 0.49289 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
9 Q9Y3S1 WNK2 0.49246 cell population proliferation GO:0008283
cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
...
10 H3BV60 TGFBR3L 0.49178 anatomical structure development GO:0048856
cell differentiation GO:0030154
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARMPGPVPGPIPSSVPGLASAPDPHQQLAFLEINRQLLFREYL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDD....DDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDD.............D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D...D.................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDDDDDDDDDDDDDDDDD.......................
RICH_[AE]:                                                          EArEgpvAEA                                               
RICH_[AG]:                                                GAvGGGvrvqeAreGpvAeAA                                              
RICH_[AM]:                                                                 AeAArsMArM                                        
RICH_[AP]:                                                               PvAeAArsmArmPgPvPgPiP                               
RICH_[AR]:                                                       RvqeARegpvAeAARsmAR                                         
RICH_[AV]:                                                 AVgggVrVqeAregpVAeAA                                              
RICH_[A]:                                                            AregpvAeAArsmA                                          
RICH_[G]:                                      GtasGvsdvlrGavGGG                                                             
RICH_[P]:                                                                            PgPvPgPiPssvPglasaPdP                   
RICH_[R]:                                                        RvqeaRegpvaeaaRsmaR                                         
RICH_[V]:                                  VpqVgtasgVsdVlrgaVgggVrVqearegpV                                                  
RICH_[GV]:                             GdssVpqVGtasGVsdVlrGaVGGGV                                                            
RICH_[MP]:                                                                       MarMPgPvPgPiP                               
RICH_fLPS_[P]:                                                                       PgPvPgPiPssvPglasaPdP                   
RICH_fLPS_[V]:                                VgtasgVsdVlrgaVgggVrV                                                          
RICH_MOBI_[PV]:                                                                        PVPgPiPssVP                           
RICH_MOBI_[M]:           MaeptglleM                                                                                          
RICH_MOBI_[P]:                                                                       PgPvPgPiPssvP                           
RICH_MOBI_[LM]:          MaeptgLLeMseL                                                                                       
RICH_MOBI_[MP]:                                                                  MarMPgPvPgPiPssvP                           

                                          120                 140                 160                   
AA:                      DGSSMIPVRLLRDFEERRRLFVEGCKAREAAFDADPPQMDFAAVAFTVALTASEALSPLAD
STMI:                                                                                 
DO_DISOPRED3:            .....................................................D..DDDDD
DO_IUPRED2A:             .............................................................
DO_SPOTD:                .......................................................DDDDDD
CONSENSUS:               ........................................................DDDDD
CONSENSUS_MOBI:          .............................................................