Q96DE0 NUD16_HUMAN
Gene name: NUDT16
Protein name: U8 snoRNA-decapping enzyme
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NI22 | MCFD2 | 0.55393 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 2 | Q8NFR9 | IL17RE | 0.48578 | response to stress GO:0006950 signal transduction GO:0007165 |
| 3 | A4D126 | CRPPA | 0.44721 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 4 | Q9GZS1 | POLR1E | 0.41026 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q9NU19 | TBC1D22B | 0.41018 | protein transport GO:0015031 transport GO:0006810 |
| 6 | P08F94 | PKHD1 | 0.40448 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 7 | P08514 | ITGA2B | 0.30257 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 8 | A2PYH4 | HFM1 | 0.28869 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 chromosome segregation GO:0007059 ... |
| 9 | Q96LJ8 | UBXN10 | 0.27896 | cellular component assembly GO:0022607 |
| 10 | P63010 | AP2B1 | 0.23685 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MAGARRLELGEALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHV STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: ........................................................................DD.......................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDD................................................................................................. CONSENSUS_MOBI: DD..................................................................................................
120 140 160 180 AA: GSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGLKIPAHH STMI: DO_DISOPRED3: ..........................................................................................DDDDD DO_IUPRED2A: ............................................................................................... DO_SPOTD: ....................................................................................D.DDDDDDDDD CONSENSUS: ..........................................................................................DDDDD CONSENSUS_MOBI: ..................................................................................DDDDDDDDDDDDD RICH_MOBI_[HI]: IsglkIpaHH