Q96EC8 YIPF6_HUMAN
Gene name: YIPF6
Protein name: Protein YIPF6
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y6R6 | ZNF780B | 0.79085 | |
| 2 | O60928 | KCNJ13 | 0.6262 | transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q9H2U9 | ADAM7 | 0.56489 | |
| 4 | P02708 | CHRNA1 | 0.55081 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cell-cell signaling GO:0007267 ... |
| 5 | Q9NPH2 | ISYNA1 | 0.53799 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 6 | Q9Y6K5 | OAS3 | 0.53799 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 7 | P49910 | ZNF165 | 0.53243 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | P15941 | MUC1 | 0.50836 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cell cycle GO:0007049 ... |
| 9 | P49116 | NR2C2 | 0.49844 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q495C1 | RNF212 | 0.49716 | cell cycle GO:0007049 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVT STMI: MMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDDD................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................ CONSENSUS_MOBI: .................................................................................... RICH_[AP]: AeAeesPgdPgtAsPrPlfA RICH_[I]: IsIsqdIpvegeItIpmrsrI RICH_[IR]: ItIpmRsRIR RICH_fLPS_[I]: IsIsqdIpvegeItIpmrsrI
120 140 160 180 200 AA: LALMLQRDSADSEKDGGPQFAEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVAST STMI: MMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .......... .......... ................. CONSENSUS_MOBI: .......... .......... .................
220 AA: AFLADSQPPNRRALAVYPVFLFYFVISWMILTFTPQ STMI: MMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...................................D DO_IUPRED2A: .................................... DO_SPOTD: .................................DDD CONSENSUS: ....... ..D CONSENSUS_MOBI: ....... ...