List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q9NYK6	EURL	0.92735	anatomical structure development GO:0048856 cell differentiation GO:0030154
2	Q86VY9	TMEM200A	0.92355
3	Q08ER8	ZNF543	0.92195	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
4	Q9Y2P7	ZNF256	0.92042	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
5	Q96QU6	ACCS	0.85198	biosynthetic process GO:0009058 small molecule metabolic process GO:0044281
6	Q99541	PLIN2	0.84451	transport GO:0006810
7	Q96KK3	KCNS1	0.83438	cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ...
8	Q96T54	KCNK17	0.82587	transmembrane transport GO:0055085 transport GO:0006810
9	Q6IN84	MRM1	0.82048	cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254
10	Q9UGC6	RGS17	0.80887	signal transduction GO:0007165

                                           20                  40                  60                  80   
AA:                      MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFAETGSVKDFGIQPVEDKGACRLPLCSLPGEPGNGPDQQLQRSPPEFQ
STMI:                                                                                                                     
DO_DISOPRED3:            DDDDDD...............................................................................DDDDDDDDDDDD
DO_IUPRED2A:             ..................................................................................DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDD.....................................................................DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDD............................................................................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............................................................................DDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[Q]:                                                                                                 QQlQrsppefQ