Q96H20 SNF8_HUMAN
Gene name: SNF8
Protein name: Vacuolar-sorting protein SNF8
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q969F0 | FATE1 | 0.75219 | cell death GO:0008219 homeostatic process GO:0042592 |
| 2 | Q6PI77 | BHLHB9 | 0.71343 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 3 | P35249 | RFC4 | 0.69368 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q9UG63 | ABCF2 | 0.68222 | |
| 5 | Q9NQS5 | GPR84 | 0.6563 | immune system process GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
| 6 | P07305 | H1-0 | 0.63552 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 7 | Q5JPE7 | NOMO2 | 0.63549 | |
| 8 | P16402 | H1-3 | 0.63126 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | A6NEY3 | GOLGA6L3 | 0.62819 | |
| 10 | Q9UNZ5 | C19orf53 | 0.61902 |
20 40 60 80 100 AA: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYEL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDD......................................................................................... CONSENSUS: DDDDDDDDDDD......................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... RICH_MOBI_[AK]: AgAiAKKKlAeAKyKergtvlA RICH_MOBI_[A]: AgAiAkkklAeA RICH_MOBI_[K]: KKKlaeaKyK RICH_fLPS_MOBI_[K]: KKKlaeaKyK
120 140 160 180 200 AA: GVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKA STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: SLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP STMI: DO_DISOPRED3: ............................................DDDDDDDDDDDDDD DO_IUPRED2A: ......................................................D... DO_SPOTD: ...................................................DDDDDDD CONSENSUS: ...................................................DDDDDDD CONSENSUS_MOBI: ....................................................DDDDDD