List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40   
AA:                      MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM
STMI:                                  MMMMMMMMMMMMMMMMMMMMMMM                    
DO_DISOPRED3:            DDD...........................................DDDD.DDDDDD
DO_IUPRED2A:             ..................................................D......
DO_SPOTD:                DDDD........................................DDDDDDDDDDDDD
CONSENSUS:               DDD...........                       .........DDDDDDDDDDD
CONSENSUS_MOBI:          ..............                       ....................