Q96IX5 ATPMD_HUMAN

Gene name: ATP5MD
Protein name: ATP synthase membrane subunit DAPIT, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40  
AA:                      MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT
STMI:                                          MMMMMMMMMMMMMMMMMMMMMMM             
DO_DISOPRED3:            DDDDDD...............................................DDDDD
DO_IUPRED2A:             ..........................................................
DO_SPOTD:                DDDDDDDDD........................................DDDDDDDDD
CONSENSUS:               DDDDDD................                       ........DDDDD
CONSENSUS_MOBI:          ......................                       .............