Q96IX5 ATPMD_HUMAN
Gene name: ATP5MD
Protein name: ATP synthase membrane subunit DAPIT, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT STMI: MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDD...............................................DDDDD DO_IUPRED2A: .......................................................... DO_SPOTD: DDDDDDDDD........................................DDDDDDDDD CONSENSUS: DDDDDD................ ........DDDDD CONSENSUS_MOBI: ...................... .............