Q96J77 TPD55_HUMAN
Gene name: TPD52L3
Protein name: Tumor protein D55
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q4ZJI4 | SLC9B1 | 0.94428 | homeostatic process GO:0042592 reproduction GO:0000003 transmembrane transport GO:0055085 ... |
| 2 | O60522 | TDRD6 | 0.85727 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 3 | A6NFA0 | FAM205C | 0.78352 | |
| 4 | Q9H8X9 | ZDHHC11 | 0.77458 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 5 | Q96KC9 | CABS1 | 0.77239 | reproduction GO:0000003 |
| 6 | O75971 | SNAPC5 | 0.76357 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q6XPS3 | TPTE2 | 0.74008 | biosynthetic process GO:0009058 |
| 8 | Q15021 | NCAPD2 | 0.71956 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 9 | Q9Y6L7 | TLL2 | 0.71892 | anatomical structure development GO:0048856 cell differentiation GO:0030154 extracellular matrix organization GO:0030198 ... |
| 10 | P13611 | VCAN | 0.71551 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALST STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD................................................................DDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ RICH_[T]: TeTsvgTyeshsT RICH_[ET]: TETsvgTyEshsTsElE RICH_MOBI_[E]: EshstsElEdltEpE RICH_MOBI_[T]: TeTsvgTyeshsTseledlT RICH_MOBI_[ET]: TETsvgTyEshsTsElEdlTE
120 AA: MGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP STMI: DO_DISOPRED3: ..............................DDDDDDDDDD DO_IUPRED2A: ........................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..............................DDDDDDDDDD CONSENSUS_MOBI: ........................................