Q96L11 LCFC1_HUMAN

Gene name: LLCFC1
Protein name: Sperm-egg fusion protein LLCFC1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NYK6 EURL 0.92735 anatomical structure development GO:0048856
cell differentiation GO:0030154
2 Q86VY9 TMEM200A 0.92355
3 Q08ER8 ZNF543 0.92195 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q9Y2P7 ZNF256 0.92042 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q96QU6 ACCS 0.85198 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
6 Q99541 PLIN2 0.84451 transport GO:0006810
7 Q96KK3 KCNS1 0.83438 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
transmembrane transport GO:0055085
...
8 Q96T54 KCNK17 0.82587 transmembrane transport GO:0055085
transport GO:0006810
9 Q6IN84 MRM1 0.82048 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
10 Q9UGC6 RGS17 0.80887 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MPPLAPQLCRAVFLVPILLLLQVKPLNGSPGPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEEDQSSKTAAVHKHSFHLSFCFSLASVM
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                        
DO_DISOPRED3:            DDDD.............D..DDDDDDDDDDDDDDDDDDDDDD..........................................................
DO_IUPRED2A:             ............................DDDDDDDDDDDDDDDDDDDDD..D.................DDD..DDDDDDD...................
DO_SPOTD:                DDD....................DDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDD......................
CONSENSUS:                                           DDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDD......................
CONSENSUS_MOBI:                                      DDDDDDDDDDDDDDDDDDDDDDD.................................................
RICH_MOBI_[Q]:                                               QtektpsadQnQeQ                                                  

                                          120                  
AA:                      VFSGGPLRRTFPNIQLCFMLTH
STMI:                                          
DO_DISOPRED3:            ......................
DO_IUPRED2A:             ......................
DO_SPOTD:                ......................
CONSENSUS:               ......................
CONSENSUS_MOBI:          ......................