Q96LB4 VATG3_HUMAN
Gene name: ATP6V1G3
Protein name: V-type proton ATPase subunit G 3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8ND07 | BBOF1 | 0.91026 | cellular component assembly GO:0022607 |
| 2 | P23634 | ATP2B4 | 0.90573 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | Q8IWG1 | DNAI3 | 0.88302 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
| 4 | Q5BJF6 | ODF2 | 0.87606 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 5 | Q7Z6K1 | THAP5 | 0.87222 | cell cycle GO:0007049 |
| 6 | Q16363 | LAMA4 | 0.86899 | anatomical structure development GO:0048856 cell adhesion GO:0007155 embryo development GO:0009790 ... |
| 7 | Q9H0A0 | NAT10 | 0.85135 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 8 | Q9NRZ9 | HELLS | 0.83769 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell division GO:0051301 ... |
| 9 | Q7Z3B0 | SMIM15 | 0.82086 | |
| 10 | Q92963 | RIT1 | 0.8194 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLL STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDD..........DDDDDDDD...DDDDDDDDDDDD..D...D................ DO_SPOTD: DDDDD............................................................................................... CONSENSUS: DDDDD............................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. RICH_MOBI_[K]: KraKdKleeaKKrKgKrlK RICH_MOBI_[Q]: QsQgihQllQ RICH_fLPS_MOBI_[K]: eKraKdKleeaKKrKgKrlK
AA: SMVCDMKPEIHVNYRATN STMI: DO_DISOPRED3: .................D DO_IUPRED2A: ..............DDDD DO_SPOTD: ................DD CONSENSUS: ................DD CONSENSUS_MOBI: ..................