Q96M19 CL067_HUMAN
Gene name: LINC00477
Protein name: Putative transmembrane protein encoded by LINC00477
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92530 | PSMF1 | 0.69208 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q9BUH6 | PAXX | 0.66838 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 3 | Q8WWR8 | NEU4 | 0.65604 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q8N2S1 | LTBP4 | 0.65598 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 5 | Q9UQ16 | DNM3 | 0.65106 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 6 | Q13275 | SEMA3F | 0.64085 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 7 | A6NEV1 | PRR23A | 0.63934 | |
| 8 | O60304 | ZNF500 | 0.62895 | |
| 9 | Q9UKN7 | MYO15A | 0.62824 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 cytoskeleton-dependent intracellular transport GO:0030705 ... |
| 10 | O15353 | FOXN1 | 0.61979 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MLPFFSNTTSKSVSVSSFQGSPATPLSFLFFFFLCRAGSSMTGCFTFFLDFIFFFAGVLGPSPMGMYSGASTLTGFFLLRFLGQLSMDLEGLEWLGRASP STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDD ..... . ................. CONSENSUS_MOBI: .............. ..... . .................
120 140 160 AA: SWWIFFSSSPSHRVPWGSCASASAPRLPVPHPPSPLSKCPQHPRPRRTKGPGLRKLWGPGPPFFPS STMI: DO_DISOPRED3: .................................................................. DO_IUPRED2A: ................................DDDDDDDDDDDDDDDDDDDDD............. DO_SPOTD: ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........DDDDDD CONSENSUS: ................................DDDDDDDDDDDDDDDDDDDD.............. CONSENSUS_MOBI: ..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[P]: PsPlskcPqhPrPrrtkgP RICH_MOBI_[PR]: PRPRRtkgPglRklwgPgPP RICH_MOBI_[P]: PvPhPPsPlskcPqhPrPrrtkgP RICH_MOBI_[R]: RpRRtkgpglR RICH_MOBI_[FG]: GpGlrklwGpGppFF RICH_MOBI_[FP]: PglrklwgPgPPFFP RICH_MOBI_[GP]: PrPrrtkGPGlrklwGPGPP RICH_MOBI_[GR]: RpRRtkGpGlRklwGpG RICH_MOBI_[HP]: PvPHPPsPlskcPqHPrP