Q96M19 CL067_HUMAN

Gene name: LINC00477
Protein name: Putative transmembrane protein encoded by LINC00477

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q92530 PSMF1 0.69208 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 Q9BUH6 PAXX 0.66838 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
3 Q8WWR8 NEU4 0.65604 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
4 Q8N2S1 LTBP4 0.65598 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
5 Q9UQ16 DNM3 0.65106 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
6 Q13275 SEMA3F 0.64085 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
7 A6NEV1 PRR23A 0.63934
8 O60304 ZNF500 0.62895
9 Q9UKN7 MYO15A 0.62824 anatomical structure development GO:0048856
cytoskeleton organization GO:0007010
cytoskeleton-dependent intracellular transport GO:0030705
...
10 O15353 FOXN1 0.61979 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MLPFFSNTTSKSVSVSSFQGSPATPLSFLFFFFLCRAGSSMTGCFTFFLDFIFFFAGVLGPSPMGMYSGASTLTGFFLLRFLGQLSMDLEGLEWLGRASP
STMI:                                  MMMMMMMMMMMMMMMMMMMMM     MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM                 
DO_DISOPRED3:            DDDDDDDDDDDDDD......................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD...............................................................................
CONSENSUS:               DDDDDDDDDDDDDD                     .....                     .                     .................
CONSENSUS_MOBI:          ..............                     .....                     .                     .................

                                          120                 140                 160              
AA:                      SWWIFFSSSPSHRVPWGSCASASAPRLPVPHPPSPLSKCPQHPRPRRTKGPGLRKLWGPGPPFFPS
STMI:                                                                                      
DO_DISOPRED3:            ..................................................................
DO_IUPRED2A:             ................................DDDDDDDDDDDDDDDDDDDDD.............
DO_SPOTD:                ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........DDDDDD
CONSENSUS:               ................................DDDDDDDDDDDDDDDDDDDD..............
CONSENSUS_MOBI:          ..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                                                PsPlskcPqhPrPrrtkgP               
RICH_MOBI_[PR]:                                                    PRPRRtkgPglRklwgPgPP    
RICH_MOBI_[P]:                                      PvPhPPsPlskcPqhPrPrrtkgP               
RICH_MOBI_[R]:                                                      RpRRtkgpglR            
RICH_MOBI_[FG]:                                                           GpGlrklwGpGppFF  
RICH_MOBI_[FP]:                                                            PglrklwgPgPPFFP 
RICH_MOBI_[GP]:                                                    PrPrrtkGPGlrklwGPGPP    
RICH_MOBI_[GR]:                                                     RpRRtkGpGlRklwGpG      
RICH_MOBI_[HP]:                                     PvPHPPsPlskcPqHPrP