Q96MV1 TLCD4_HUMAN
Gene name: TLCD4
Protein name: TLC domain-containing protein 4
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92616 | GCN1 | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 response to stress GO:0006950 |
| 2 | O95140 | MFN2 | 0.5547 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 3 | Q9NWL6 | ASNSD1 | 0.53916 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 4 | Q6UWP7 | LCLAT1 | 0.50252 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 |
| 5 | Q9BV44 | THUMPD3 | 0.49719 | cellular nitrogen compound metabolic process GO:0034641 |
| 6 | P26715 | KLRC1 | 0.49581 | immune system process GO:0002376 signal transduction GO:0007165 |
| 7 | Q8N6Q8 | METTL25 | 0.49375 | |
| 8 | Q8IUN9 | CLEC10A | 0.48507 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 9 | Q13740 | ALCAM | 0.45296 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 10 | P25929 | NPY1R | 0.44182 | anatomical structure development GO:0048856 carbohydrate metabolic process GO:0005975 circulatory system process GO:0003013 ... |
20 40 60 80 100 AA: MEINTKLLISVTCISFFTFQLLFYFVSYWFSAKVSPGFNSLSFKKKIEWNSRVVSTCHSLVVGIFGLYIFLFDEATKADPLWGGPSLANVNIAIASGYLI STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMM DO_DISOPRED3: DDDDD..D...D.....DD................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDD............................................................................................... CONSENSUS: DDDDD. ......................... ................ CONSENSUS_MOBI: ...... ......................... ................
120 140 160 180 200 AA: SDLSIIILYWKVIGDKFFIMHHCASLYAYYLVLKNGVLAYIGNFRLLAELSSPFVNQRWFFEALKYPKFSKAIVINGILMTVVFFIVRIASMLPHYGFMY STMI: MMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ............. ............................ ....... CONSENSUS_MOBI: ............. ............................ .......
220 240 260 AA: SVYGTEPYIRLGVLIQLSWVISCVVLDVMNVMWMIKISKGCIKVISHIRQEKAKNSLQNGKLD STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...............................................DDDDDDDDDDDDDDDD DO_IUPRED2A: ............................................................... DO_SPOTD: ..............................................DDDDDDDDDDDDDDDDD CONSENSUS: .......... ................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: .......... ................................ RICH_[KN]: KaKNslqNgK