Q96NL8 CH037_HUMAN

Gene name: C8orf37
Protein name: Protein C8orf37

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P51965 UBE2E1 0.74253 catabolic process GO:0009056
cell cycle GO:0007049
cellular protein modification process GO:0006464
...
2 P31644 GABRA5 0.72593 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
3 Q6YP21 KYAT3 0.70296 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
4 Q0P651 ABHD18 0.6669
5 Q9BPU6 DPYSL5 0.6342 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
6 P58417 NXPH1 0.62932
7 Q96LW1 ZNF354B 0.61925 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 Q9NWW7 C2orf42 0.61456
9 Q15761 NPY5R 0.6145 anatomical structure development GO:0048856
cell death GO:0008219
cell population proliferation GO:0008283
...
10 Q8N0W5 IQCK 0.61372

                                           20                  40                  60                  80                 100
AA:                      MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEILEEPNLDKKPSKLKSKSSGNTSVRASIEGL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD...D............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDD...
DO_IUPRED2A:             DDDDD..............D.......DDDDDDDDDDDDDDDDDDDDDDDDD.D.......................DDDDDDDDDDDD...........
DO_SPOTD:                DD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS:               DDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDD...
CONSENSUS_MOBI:          .........................DDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
RICH_[G]:                                        GmveqpkGcGGG                                                                
RICH_[K]:                                                             KaKetlrstetfKK                                         
RICH_[S]:                                                                                                SklkSkSSgntSvraS    
RICH_[T]:                                                    ThssdrnqakakeTlrsTeT                                            
RICH_[KS]:                                                                                            KKpSKlKSKSSgntSvraS    
RICH_fLPS_[K]:                                                                                        KKpsKlKsKs             

                                          120                 140                 160                 180                 200
AA:                      GKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQL
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                      
AA:                      RWVCGKH
STMI:                           
DO_DISOPRED3:            .......
DO_IUPRED2A:             .......
DO_SPOTD:                .......
CONSENSUS:               .......
CONSENSUS_MOBI:          .......