Q99417 MYCBP_HUMAN

Gene name: MYCBP
Protein name: c-Myc-binding protein

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- reproduction GO:0000003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y243 AKT3 0.89443 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...
2 Q96M32 AK7 0.88492 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
3 Q9GZL7 WDR12 0.88492 cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
...
4 Q0VD86 INCA1 0.85166 cell cycle GO:0007049
cell death GO:0008219
cell population proliferation GO:0008283
...
5 P31749 AKT1 0.8165 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 A8MPS7 YDJC 0.81373 carbohydrate metabolic process GO:0005975
7 Q99965 ADAM2 0.81373 cell adhesion GO:0007155
membrane organization GO:0061024
nervous system process GO:0050877
...
8 Q9Y487 ATP6V0A2 0.81044 catabolic process GO:0009056
homeostatic process GO:0042592
immune system process GO:0002376
...
9 Q16342 PDCD2 0.79436 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
10 O96024 B3GALT4 0.79262 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464

                                           20                  40                  60                  80                 100
AA:                      MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD...........................................................................................DDDDD
DO_IUPRED2A:             .DD..........................................DDDDDDDD...........D.......................DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDD...................................................................................DDDDDDDDD
CONSENSUS:               DDDD.......................................................................................DDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[E]:                                                                                                             EppqEEk

                                          
AA:                      RAE
STMI:                       
DO_DISOPRED3:            DDD
DO_IUPRED2A:             DDD
DO_SPOTD:                DDD
CONSENSUS:               DDD
CONSENSUS_MOBI:          ...
RICH_[E]:                raE