Q99595 TI17A_HUMAN

Gene name: TIMM17A
Protein name: Mitochondrial import inner membrane translocase subunit Tim17-A

List of terms from Generic GO subset, which this protein is a part of:
- protein maturation GO:0051604
- protein targeting GO:0006605
- protein transport GO:0015031
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A8MWL6 n/a 0.85453
2 Q4U2R8 SLC22A6 0.71812 transport GO:0006810
3 O43759 SYNGR1 0.65682 cell-cell signaling GO:0007267
immune system process GO:0002376
membrane organization GO:0061024
...
4 Q6XE24 RBMS3 0.64702 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
5 P62684 HERVK_113 0.61928 biological process involved in symbiotic interaction GO:0044403
6 Q9HAV7 GRPEL1 0.61838 protein folding GO:0006457
protein targeting GO:0006605
protein transport GO:0015031
...
7 Q5SSQ6 SAPCD1 0.6104
8 Q9UGC6 RGS17 0.60914 signal transduction GO:0007165
9 Q99541 PLIN2 0.60034 transport GO:0006810
10 Q96PN7 TRERF1 0.59644 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTG
STMI:                                    MMMMMMMMMMMMMMMMMMMMM                         MMMMMMMMMMMMMMM                       
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDD...............................................................................................
CONSENSUS:               DD..............                     .........................               .......................
CONSENSUS_MOBI:          ................                     .........................               .......................

                                          120                 140                 160         
AA:                      AILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
STMI:                                MMMMMMMMMMMMMMMMMMMMM                                      
DO_DISOPRED3:            .............................................DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............................................DDDDDDDDDD.DD............
DO_SPOTD:                ......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ............                     ............DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............                     ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PY]:                                                                 PsqlPstqlPssPfgdYrqY 
RICH_[QY]:                                                                   QlpstQlpsspfgdYrQYQ
RICH_[Q]:                                                                    QlpstQlpsspfgdyrQyQ
RICH_MOBI_[QY]:                                                              QlpstQlpsspfgdYrQYQ
RICH_MOBI_[Q]:                                                               QlpstQlpsspfgdyrQyQ