Q99909 SSX3_HUMAN

Gene name: SSX3
Protein name: Protein SSX3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5VW32 BROX 0.61776
2 O60224 SSX4 0.60207 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 P25942 CD40 0.5578 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 Q9UHD1 CHORDC1 0.55047 cell cycle GO:0007049
cellular protein modification process GO:0006464
cytoskeleton organization GO:0007010
...
5 O43529 CHST10 0.52185 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell adhesion GO:0007155
6 P16591 FER 0.51861 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
7 Q9UIM3 FKBPL 0.50307 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
8 Q99062 CSF3R 0.49061 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
9 Q8TCC7 SLC22A8 0.48311 circulatory system process GO:0003013
transport GO:0006810
10 Q92598 HSPH1 0.46315 biosynthetic process GO:0009058
cell adhesion GO:0007155
immune system process GO:0002376
...

                                           20                  40                  60                  80                 100
AA:                      MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDD.DDDDDDD..............................................................DDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDD....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD.........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[D]:                                                                                             DfqgnDfDnD             
RICH_[N]:                                                                                                 NdfdNdpNrgN        
RICH_[Q]:                                                                                               QgndfdndpnrgnQvQrpQ  
RICH_[DF]:                                                                                            DFqgnDFDnD             
RICH_[DN]:                                                                                            DfqgNDfDNDpNrgN        
RICH_[FN]:                                                                                             FqgNdFdNdpNrgN        
RICH_[FQ]:                                                                                                             QrpQmt
RICH_[NQ]:                                                                                              QgNdfdNdpNrgNQvQrpQ  

                                          120                 140                 160                 180            
AA:                      FGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE
STMI:                                                                                                            
DO_DISOPRED3:            DDD..........DDD..DDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDD........................DDDDDD
DO_IUPRED2A:             D...DDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........DDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........DDDDDDDD
CONSENSUS_MOBI:          ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
RICH_[K]:                         KimpKKpaeegnvsK                                                                
RICH_[EK]:                        KimpKKpaEEgnvsKEvpE                                                            
RICH_[EP]:                       PkimPkkPaEEgnvskEvPE                                                            
RICH_[FQ]:               FgrlQgiF                                                                                
RICH_[KP]:                       PKimPKKPaeegnvsKevP