Q99966 CITE1_HUMAN

Gene name: CITED1
Protein name: Cbp/p300-interacting transactivator 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790
- immune system process GO:0002376
- nucleocytoplasmic transport GO:0006913
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IVT5 KSR1 0.7014 cell population proliferation GO:0008283
cellular protein modification process GO:0006464
signal transduction GO:0007165
2 Q9UPN9 TRIM33 0.68072 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
3 Q9H330 TMEM245 0.67538
4 Q3MII6 TBC1D25 0.66024 catabolic process GO:0009056
protein transport GO:0015031
transport GO:0006810
5 Q9UI36 DACH1 0.62789 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
6 Q8IWQ3 BRSK2 0.62634 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
7 Q13233 MAP3K1 0.6232 cell cycle GO:0007049
cellular protein modification process GO:0006464
immune system process GO:0002376
...
8 A1A4S6 ARHGAP10 0.61785 cell death GO:0008219
cytoskeleton organization GO:0007010
signal transduction GO:0007165
9 Q9ULI4 KIF26A 0.61773 anatomical structure development GO:0048856
growth GO:0040007
immune system process GO:0002376
...
10 Q96RY5 CRAMP1 0.61633

                                           20                  40                  60                  80                 100
AA:                      MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMHLQKL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD..DD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DD...
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
RICH_[PS]:                                                                        SgaPtSSSgSPigSPtttPP                       
RICH_[PT]:                                                                           PTsssgsPigsPTTTPPTkPPsfnlhPaP           
RICH_[AL]:                                                                                                         LLAsmhLqkL
RICH_[H]:                                                                                                     HpapHllasmH    
RICH_[L]:                                                                                                          LLasmhLqkL
RICH_[P]:                                                                            PtsssgsPigsPtttPPtkPPsfnlhPaP           
RICH_[Q]:                                                                                                                 Qkl
RICH_[S]:                                                                   SngtkaSgaptSSSgSpigS                             
RICH_[T]:                                                                      TkasgapTsssgspigspTTTppT                      
RICH_[ST]:                                                                     TkaSgapTSSSgSpigSpTTT                         
RICH_[GS]:                                                               GvaSnGtkaSGaptSSSGS                                 
RICH_[HP]:                                                                                          PPtkPPsfnlHPaPH          
RICH_[LP]:                                                                                              PPsfnLhPaPhLLasmhL   
RICH_[MQ]:                                                                                                             MhlQkl
RICH_MOBI_[PS]:                                                                        SSSgSPigSPtttPPtkPPS                  
RICH_MOBI_[PT]:                                                                      PTsssgsPigsPTTTPPTkPPsfnlhP             
RICH_MOBI_[P]:                                                                       PtsssgsPigsPtttPPtkPPsfnlhP             
RICH_MOBI_[S]:                                                                    SgaptSSSgSpigS                             
RICH_MOBI_[T]:                                                                 TkasgapTsssgspigspTTTppT                      
RICH_MOBI_[ST]:                                                                TkaSgapTSSSgSpigSpTTT                         
RICH_MOBI_[GS]:                                                             SnGtkaSGaptSSSGSpiGS                             

                                          120                 140                 160                 180       
AA:                      NSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
STMI:                                                                                                                 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
DO_IUPRED2A:             ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......D..................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................DDD.
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................
CONSENSUS_MOBI:          .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................
RICH_[AG]:                    GmAAAtpGqpGeAG       GAqAGGAeslspsAGAqspA                                               
RICH_[AL]:               nsqyqgmAAA                                                                                   
RICH_[AQ]:                 QyQgmAAAtpgQpgeAgplQ                                                                       
RICH_[A]:                                           AqAggAeslspsAgAqspA                                               
RICH_[G]:                            GqpGeaGplqnwdfGaqaGG                                                             
RICH_[Q]:                nsQyQgmaaatpgQ                                                                               
RICH_[GQ]:                 QyQGmaaatpGQpGeaGplQ                                                                       
RICH_[MQ]:               nsQyQgM                                                                                      
RICH_MOBI_[AG]:               GmAAAtpGqpGeAG       GAqAGGAeslspsAGAqspA                                               
RICH_MOBI_[A]:                                      AqAggAeslspsAgAqspA                                               
RICH_MOBI_[G]:                       GqpGeaGplqnwdfGaqaGG