Q9BQE4 SELS_HUMAN

Gene name: SELENOS
Protein name: Selenoprotein S

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell death GO:0008219
- cellular protein modification process GO:0006464
- generation of precursor metabolites and energy GO:0006091
- homeostatic process GO:0042592
- immune system process GO:0002376
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NZQ7 CD274 0.80257 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
2 Q9Y3N9 OR2W1 0.80257
3 Q9Y6A9 SPCS1 0.80257 biological process involved in symbiotic interaction GO:0044403
cellular nitrogen compound metabolic process GO:0034641
protein maturation GO:0051604
...
4 A8MVJ9 n/a 0.77329 cellular protein modification process GO:0006464
response to stress GO:0006950
5 Q6P2S7 TTC41P 0.7364
6 O60486 PLXNC1 0.71822 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
7 P46059 SLC15A1 0.71784 protein transport GO:0015031
transmembrane transport GO:0055085
transport GO:0006810
8 P78348 ASIC1 0.71784 cell-cell signaling GO:0007267
cellular component assembly GO:0022607
nervous system process GO:0050877
...
9 Q6ZU15 SEPTIN14 0.71021 cell cycle GO:0007049
cell division GO:0051301
10 Q86V20 SHLD2 0.71021 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...

                                           20                  40                  60                  80                 100
AA:                      MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKH
STMI:                                               MMMMMMMMMMMMMMMMMMMMM                                                    
DO_DISOPRED3:            DDDDDDDDDDDDDD......................................................................................
DO_IUPRED2A:             DDD..DDD....................................................................................DDDD.DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDD.........................................DDDDDDDDDDD...............................
CONSENSUS:               DDDDDDDD...................                     ....................................................
CONSENSUS_MOBI:          ...........................                     ....................................................

                                          120                 140                 160                 180           
AA:                      KEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG
STMI:                                                                                                             
DO_DISOPRED3:            ...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDD
CONSENSUS_MOBI:          .........................................................................................
RICH_[G]:                                                                                              GrrGpssGGxG
RICH_[K]:                                                KKpqeedspgpstssvlKrK                                     
RICH_fLPS_[X]:                                                                                         grrgpssggX