Q9BUY7 EFC11_HUMAN
Gene name: EFCAB11
Protein name: EF-hand calcium-binding domain-containing protein 11
List of terms from Generic GO subset, which this protein is a part of:
- cytoskeleton organization GO:0007010
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O75173 | ADAMTS4 | 0.50617 | anatomical structure development GO:0048856 extracellular matrix organization GO:0030198 |
| 2 | Q9H6A0 | DENND2D | 0.48536 | |
| 3 | Q6ZRI8 | ARHGAP36 | 0.34131 | signal transduction GO:0007165 |
| 4 | Q8N957 | ANKFN1 | 0.32083 | |
| 5 | O95452 | GJB6 | 0.29348 | anatomical structure development GO:0048856 cell death GO:0008219 cell junction organization GO:0034330 ... |
| 6 | Q75V66 | ANO5 | 0.28059 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | O60359 | CACNG3 | 0.27692 | circulatory system process GO:0003013 nervous system process GO:0050877 protein targeting GO:0006605 ... |
| 8 | O75953 | DNAJB5 | 0.25935 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 protein folding GO:0006457 ... |
| 9 | O95977 | S1PR4 | 0.24115 | homeostatic process GO:0042592 immune system process GO:0002376 signal transduction GO:0007165 |
| 10 | P17787 | CHRNB2 | 0.2277 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
20 40 60 80 100 AA: MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPNTSGILLEGFLNIVRKKKEAQRYRNEVRHIF STMI: DO_DISOPRED3: DDDDDDDDDDD......................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDD......................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[FR]: FFseaRaRsR
120 140 160 AA: TAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYALNYGQKEA STMI: DO_DISOPRED3: .................................DDDDDDDDDDDD...............DDD DO_IUPRED2A: ............................................................... DO_SPOTD: ..........................................................DDDDD CONSENSUS: ............................................................DDD CONSENSUS_MOBI: ...............................................................