Q9BV19 CA050_HUMAN
Gene name: C1orf50
Protein name: Uncharacterized protein C1orf50
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BX73 | TM2D2 | 0.96977 | |
| 2 | Q9UL18 | AGO1 | 0.91857 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | O14904 | WNT9A | 0.8914 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 4 | Q6IWH7 | ANO7 | 0.85266 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transmembrane transport GO:0055085 ... |
| 5 | P50991 | CCT4 | 0.83749 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 6 | P06396 | GSN | 0.83378 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 7 | Q9BZ76 | CNTNAP3 | 0.76585 | cell adhesion GO:0007155 |
| 8 | Q17RQ9 | NKPD1 | 0.74726 | |
| 9 | Q6ICL7 | SLC35E4 | 0.73256 | |
| 10 | Q13064 | MKRN3 | 0.72597 | cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD..DDDDDDD..........DDDDD..............................................DDD.DD.D. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... RICH_[AG]: AApGrteGvlerqGAppAAG RICH_[A]: AAApgrtegvlerqgAppAA RICH_MOBI_[AG]: AApGrteGvlerqGAppAAGqGGA RICH_MOBI_[A]: AAApgrtegvlerqgAppAAgqggA RICH_MOBI_[G]: GrteGvlerqGappaaGqGG
120 140 160 180 AA: RDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH STMI: DO_DISOPRED3: ........................................................................................D.DDDDDDDDD DO_IUPRED2A: ................................................................................................D.. DO_SPOTD: .........................................................................................DDDDDDDDDD CONSENSUS: ..........................................................................................DDDDDDDDD CONSENSUS_MOBI: ...................................................................................................