Q9BVT8 TMUB1_HUMAN

Gene name: TMUB1
Protein name: Transmembrane and ubiquitin-like domain-containing protein 1

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95466 FMNL1 0.85971 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cytoskeleton organization GO:0007010
2 P40197 GP5 0.85778 cell adhesion GO:0007155
response to stress GO:0006950
3 Q8N6K4 n/a 0.85668
4 Q7L513 FCRLA 0.84585 cell differentiation GO:0030154
signal transduction GO:0007165
5 P09564 CD7 0.81786 immune system process GO:0002376
signal transduction GO:0007165
6 Q86XT2 VPS37D 0.81697 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular component assembly GO:0022607
...
7 Q53GA4 PHLDA2 0.80638 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
8 Q8TC26 TMEM163 0.8044 transmembrane transport GO:0055085
transport GO:0006810
9 A6NHQ4 EPOP 0.79748 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q8WXD9 CASKIN1 0.79559 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQ
STMI:                              MMMMMMMMMMMMMMMMMMMMM                                                                     
DO_DISOPRED3:            ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
DO_IUPRED2A:             DD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS:               DD........                     DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS_MOBI:          ..........                     .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AM]:                                                                    AAMAAtdsMrgeApgA                               
RICH_[AP]:                                                     PlPqPsgtPtPsqPsAAmAA                                          
RICH_[A]:                                                                     AAmAAtdsmrgeApgA                               
RICH_[P]:                                                      PlPqPsgtPtPsqP                              PePstgftatPPaPdsP 
RICH_MOBI_[AM]:                                                               AAMAAtdsMrgeApgA                               
RICH_MOBI_[AP]:                                                PlPqPsgtPtPsqPsAAmAA                                          
RICH_MOBI_[A]:                                                                AAmAAtdsmrgeApgA                               
RICH_MOBI_[P]:                                                 PlPqPsgtPtPsqP                              PePstgftatPPaPdsP 
RICH_fLPS_MOBI_[A]:                                                           AAmAAtdsmrgeApgA                               

                                          120                 140                 160                 180                 200
AA:                      EPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLL
STMI:                                                                                                                  MMMMMM
DO_DISOPRED3:            ...........................................................................DDDDDDDDDDDDDDD..........
DO_IUPRED2A:             DDDDDD.............DDD.D..DDDDDD...........D................................DDDDDDDDDDDDD...........
DO_SPOTD:                ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...........................................................................DDDDDDDDDDDDDDD....      
CONSENSUS_MOBI:          D.............................................................................................      
RICH_[P]:                                                                                            PPnPPcPPgsePgP          
RICH_fLPS_[P]:                                                                                      gPPnPPcPPgsePgP          

                                          220                 240              
AA:                      PLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP
STMI:                    MMMMMMMMMMMMMMM     MMMMMMMMMMMMMMMMMMMMM     
DO_DISOPRED3:            ..............................................
DO_IUPRED2A:             ..............................................
DO_SPOTD:                DDDDDDDDDDD.............DDD...............DDDD
CONSENSUS:                              .....                     .....
CONSENSUS_MOBI:                         .....                     .....