Q9BYJ0 FGFP2_HUMAN

Gene name: FGFBP2
Protein name: Fibroblast growth factor-binding protein 2

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y6V0 PCLO 0.67438 anatomical structure development GO:0048856
cell junction organization GO:0034330
cell-cell signaling GO:0007267
...
2 Q8IWT6 LRRC8A 0.65892 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
3 Q96PD2 DCBLD2 0.646 growth GO:0040007
response to stress GO:0006950
signal transduction GO:0007165
4 Q9H3P2 NELFA 0.6446 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 Q8NEZ4 KMT2C 0.64214 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 O95944 NCR2 0.63879 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
7 Q14676 MDC1 0.63235 cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
8 A4UGR9 XIRP2 0.63188 anatomical structure development GO:0048856
cell junction organization GO:0034330
cytoskeleton organization GO:0007010
9 P26717 KLRC2 0.62854 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
10 Q9HCI5 MAGEE1 0.62404

                                           20                  40                  60                  80                 100
AA:                      MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELR
STMI:                    SSSSSSSSSSSSSSSSSSS                                                                                 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................
DO_IUPRED2A:             .........................DDDDDDDDD..DDD....DDDD...............................................D.....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................
CONSENSUS:                                  DDDDDDDDDDDDD....................................................................
CONSENSUS_MOBI:                             ...DDDDDDDDDDDDDDDDDDDDDDD.......................................................
RICH_MOBI_[FG]:                                    GstGeeFhFqtGG                                                             
RICH_MOBI_[FQ]:                                 QkQgstgeeFhFQ                                                                

                                          120                 140                 160                 180                 200
AA:                      RLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKK
STMI:                                                                                                                        
DO_DISOPRED3:            ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......
DO_IUPRED2A:             ...D........D...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .......DDDD..DDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
CONSENSUS:               ..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
CONSENSUS_MOBI:          ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PT]:                                                                                           PTTrPTakPTqPgPrP        
RICH_[K]:                                                                        KlteatqlgKdsmeelgKaK                        
RICH_[P]:                                                                                            PttrPtakPtqPgPrP        
RICH_[Q]:                                      QahmQQvtsslkgspepnQQ                                                          
RICH_[T]:                                                              TpslrpkaTvklTeaT                                      
RICH_[GP]:                                                                                                   PtqPGPrPGG      
RICH_MOBI_[PT]:                                                                                      PTTrPTakPTqPgPrP        
RICH_MOBI_[K]:                                                                   KlteatqlgKdsmeelgKaK                        
RICH_MOBI_[P]:                                                                                       PttrPtakPtqPgPrP        
RICH_MOBI_[Q]:                                 QahmQQvtsslkgspepnQQ                                                          
RICH_MOBI_[T]:                                                         TpslrpkaTvklTeaT                                      
RICH_MOBI_[GP]:                                                                                              PtqPGPrPGG      

                                          220                 
AA:                      KAWEHCWKPFQALCAFLISFFRG
STMI:                                           
DO_DISOPRED3:            .......................
DO_IUPRED2A:             DD.....................
DO_SPOTD:                .......................
CONSENSUS:               .......................
CONSENSUS_MOBI:          D......................