Q9GZZ8 LACRT_HUMAN

Gene name: LACRT
Protein name: Extracellular glycoprotein lacritin

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell death GO:0008219
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O14798 TNFRSF10C 0.8161 cell death GO:0008219
signal transduction GO:0007165
2 P54727 RAD23B 0.7773 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular component assembly GO:0022607
...
3 Q96EN9 REX1BD 0.73123
4 Q8N1N2 DYNAP 0.7192 cell death GO:0008219
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
5 P26992 CNTFR 0.6943 anatomical structure development GO:0048856
cell death GO:0008219
cell population proliferation GO:0008283
...
6 P42345 MTOR 0.6732 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
7 Q7Z410 TMPRSS9 0.66028
8 O75056 SDC3 0.65239 biosynthetic process GO:0009058
catabolic process GO:0009056
immune system process GO:0002376
9 P53396 ACLY 0.65187 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
10 Q14242 SELPLG 0.65122 anatomical structure development GO:0048856
cell adhesion GO:0007155
immune system process GO:0002376

                                           20                  40                  60                  80                 100
AA:                      MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALA
STMI:                    SSSSSSSSSSSSSSSSSSS                                                                                 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
DO_IUPRED2A:             ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD...................
DO_SPOTD:                DD..........DDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DDDDD.DDDD
CONSENSUS:                                  .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS_MOBI:                             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
RICH_[PT]:                                                      PneeisgPaePasPPeTTTTaqeT                                     
RICH_[AE]:                                              AqEAgtskpnEEisgpAEpA                                                 
RICH_[AP]:                                                             PAePAsPPettttAqetsAA                                  
RICH_[AT]:                                                              AepAsppeTTTTAqeTsAAAvqgTAkvT                         
RICH_[A]:                                                               AepAsppettttAqetsAAAvqgtA                            
RICH_[T]:                                                                       TTTTaqeTsaaavqgTakvT                         
RICH_[EP]:                                             PaqEagtskPnEEisgPaEP                                                  
RICH_[ET]:                                                        EEisgpaEpasppETTTTaqE                                      
RICH_fLPS_[T]:                                                                peTTTTaqeTsaaavqgTakvT                         
RICH_MOBI_[AE]:                                         AqEAgtskpnEEisgpAEpA                                                 
RICH_MOBI_[AT]:                                                         AepAsppeTTTTAqeTsAAAvqgTAkvT                         
RICH_MOBI_[AV]:                                                                          AAAVqgtAkV                          
RICH_MOBI_[A]:                                                          AepAsppettttAqetsAAAvqgtA                            
RICH_MOBI_[T]:                                                                  TTTTaqeTsaaavqgTakvT                         
RICH_MOBI_[ET]:                                                   EEisgpaEpasppETTTTaqE                                      
RICH_fLPS_MOBI_[T]:                                                           peTTTTaqeTsaaavqgTakvT                         

                                          120  
AA:                      KAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
STMI:                                                          
DO_DISOPRED3:            ......................................
DO_IUPRED2A:             ..DDDD.DDDDDDDDDD.....................
DO_SPOTD:                DDDDDDD...........................DDDD
CONSENSUS:               ..DDDD................................
CONSENSUS_MOBI:          ......................................