Q9H0H9 C4F30_HUMAN

Gene name: CYP4F30P
Protein name: Putative cytochrome P450 family member 4F30

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9HCJ5 ZSWIM6 0.7286 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
2 Q05823 RNASEL 0.69705 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q6NT16 SLC18B1 0.66271
4 Q9P291 ARMCX1 0.65646
5 Q8WXG9 ADGRV1 0.65255 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
6 Q7Z4H9 FAM220A 0.64858 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
7 P49247 RPIA 0.64403 carbohydrate metabolic process GO:0005975
generation of precursor metabolites and energy GO:0006091
small molecule metabolic process GO:0044281
8 Q8N1Y9 n/a 0.64172
9 Q96BZ9 TBC1D20 0.63806 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
10 Q9UII2 ATP5IF1 0.63187 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MVTPAGCLGGRNQGPREIPGTAFPCSSRAGQTGQAVSGAQVSSWRERQPFGGSRGPLHILGTDGNVDTTGKLGLVPTPPRIQKETKQGALCGMKPPFLPE
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD.D............................................................................................
DO_IUPRED2A:             ..DDDDDDDDDDDD...DDDDDDDD...DD.....DDDDDDDDDDDDD....DDDDDDDDDDD....DDDDDDDDDDDDD....DDD.............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDD....DDDDDDDDDDD....DDDDDDDDDDDDD....DDD.............
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................
RICH_[G]:                     GclGGrnqGpreipG                                                                                
RICH_[CG]:                    GClGGrnqGpreipGtafpC                                                                           
RICH_MOBI_[AG]:                             GtAfpcssrAGqtGqAvsGA                                                             
RICH_MOBI_[G]:                GclGGrnqGpreipG                              GGsrGplhilGtdG                                    
RICH_MOBI_[Q]:                                         QtgQavsgaQvsswrerQ                                                    
RICH_MOBI_[CG]:               GClGGrnqGpreipGtafpC                                                                           

                           
AA:                      ALLTVWWLPFVAVSLCLF
STMI:                                      
DO_DISOPRED3:            ..................
DO_IUPRED2A:             ..................
DO_SPOTD:                ...........DDDDDDD
CONSENSUS:               ..................
CONSENSUS_MOBI:          ..................