Q9H0W7 THAP2_HUMAN
Gene name: THAP2
Protein name: THAP domain-containing protein 2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8TCT6 | SPPL3 | 0.95652 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 homeostatic process GO:0042592 ... |
| 2 | Q9NRC1 | ST7 | 0.8035 | cell differentiation GO:0030154 extracellular matrix organization GO:0030198 |
| 3 | Q9Y3Q7 | ADAM18 | 0.80206 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 4 | Q99675 | CGRRF1 | 0.79135 | cell cycle GO:0007049 cell population proliferation GO:0008283 growth GO:0040007 |
| 5 | O14718 | RRH | 0.73521 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 |
| 6 | Q96BQ5 | CCDC127 | 0.73478 | |
| 7 | Q9H756 | LRRC19 | 0.72554 | biological process involved in symbiotic interaction GO:0044403 homeostatic process GO:0042592 response to stress GO:0006950 ... |
| 8 | Q99463 | NPY6R | 0.71863 | |
| 9 | Q96EF9 | ZHX1-C8orf76 | 0.69677 | |
| 10 | Q8N6Q8 | METTL25 | 0.68451 |
20 40 60 80 100 AA: MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRRLKMDAVPTIFDFCTHIKSMKLKSRNLLKKN STMI: DO_DISOPRED3: ...........................................................................................DDDDDDDDD DO_IUPRED2A: ...................................................................................................D DO_SPOTD: ......................................................................................DDDDDDDDDDDDDD CONSENSUS: ...........................................................................................DDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[N]: NllkkN RICH_[KN]: KsrNllKKN RICH_[NS]: N RICH_fLPS_[N]: NllkkN
120 140 160 180 200 AA: NSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: .DDD...DDD........................................................................DD..D.D........... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D...D..D.................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[N]: NscspagpsNlksN RICH_[S]: ScSpagpSnlkSniSS RICH_[KN]: N RICH_[NS]: NScSpagpSNlkSNiSS RICH_fLPS_[N]: NscspagpsNlksN
220 AA: EDFKILEQDQQDKTLLSLNLKQTKSTFI STMI: DO_DISOPRED3: ............................ DO_IUPRED2A: ............................ DO_SPOTD: ......................DDDDDD CONSENSUS: ............................ CONSENSUS_MOBI: ............................