Q9H106 SIRPD_HUMAN
Gene name: SIRPD
Protein name: Signal-regulatory protein delta
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0A1B0GVZ6 | MBD3L2B | 0.77715 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | Q9Y6Z4 | KIF25-AS1 | 0.74594 | |
| 3 | Q96ID5 | IGSF21 | 0.74594 | |
| 4 | Q9UFP1 | GASK1A | 0.72326 | |
| 5 | Q96SQ5 | ZNF587 | 0.71943 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | A1IGU5 | ARHGEF37 | 0.71921 | |
| 7 | Q8TAU3 | ZNF417 | 0.718 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | B2RBV5 | n/a | 0.70599 | cell cycle GO:0007049 |
| 9 | P20800 | EDN2 | 0.70295 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 10 | Q9Y3Z3 | SAMHD1 | 0.68459 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MPIPASPLHPPLPSLLLYLLLELAGVTHVFHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDF STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDD.....D............................................................................. DO_IUPRED2A: D.DD..................................................................................DDDDDDDDDDDD.D DO_SPOTD: DDDDDDD............................................................................................. CONSENSUS: ....................................................................... CONSENSUS_MOBI: .......................................................................
120 140 160 180 AA: STRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK STMI: DO_DISOPRED3: ............................................DDDDDDDDDDDDDDD.....................................D DO_IUPRED2A: D..................................DDDDDDDDDDDDDDDDDDDDDDDD......DD.............................. DO_SPOTD: ...........................................DDDDDDDDDDDDDDD.....................................DD CONSENSUS: ...........................................DDDDDDDDDDDDDDDD.....................................D CONSENSUS_MOBI: ......................................DDDDDDDDDDDDDDDDDDDD....................................... RICH_[AR]: RpAgRAgsRA RICH_MOBI_[R]: RppknRpagRagsR