Q9H246 CA021_HUMAN

Gene name: C1orf21
Protein name: Uncharacterized protein C1orf21

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N695 SLC5A8 0.7556 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
2 O00590 ACKR2 0.75321 anatomical structure development GO:0048856
homeostatic process GO:0042592
immune system process GO:0002376
...
3 Q8TDS4 HCAR2 0.73915 catabolic process GO:0009056
cell death GO:0008219
cell-cell signaling GO:0007267
...
4 P01011 SERPINA3 0.73915 homeostatic process GO:0042592
immune system process GO:0002376
response to stress GO:0006950
...
5 Q9BXY5 CAPS2 0.72175
6 Q08AN1 ZNF616 0.71784 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 O95758 PTBP3 0.69306 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q8WUH6 TMEM263 0.68685
9 P15036 ETS2 0.67985 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 P60228 EIF3E 0.67823 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MGCASAKHVATVQNEEEAQKGKNYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQENLEKSASSNVRLKTNKEVPGLVHQPRANMHISESQQEFF
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD.DD..................................DDDD.D...........DDD..DDDDDDDD..............
DO_IUPRED2A:             ...DDDDDDDDDDDDDDDDDDDDDDDDD..D.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................DDDDDDDDDDDDDDDDDDDDDDD..................
RICH_[AE]:                                                               AEEEqkiAArnqEnlEksA                                 
RICH_[E]:                                                                 EEEqkiaarnqEnlE                                    
RICH_[N]:                                                                          NqeNleksassNvrlktN                        
RICH_[EN]:                            NEEEaqkgkN                                                                             
RICH_[NQ]:                           QNeeeaQkgkNyQN                                                                          
RICH_MOBI_[N]:                        NeeeaqkgkNyqN                                   NleksassNvrlktN                        
RICH_MOBI_[NQ]:                      QNeeeaQkgkNyQN                                                                          
RICH_MOBI_[NV]:                                                                               NVrlktNkeV                     

                                          120                   
AA:                      RMLDEKIEKGRDYCSEEEDIT
STMI:                                         
DO_DISOPRED3:            ...............DDDDDD
DO_IUPRED2A:             DDD.......DDDDDDDDDDD
DO_SPOTD:                ........DDDDDDDDDDDDD
CONSENSUS:               ..........DDDDDDDDDDD
CONSENSUS_MOBI:          .....................