Q9H4R4 CT191_HUMAN

Gene name: NCOR1P1
Protein name: Putative nuclear receptor corepressor 1-like protein NCOR1P1

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y2X0 MED16 0.6839 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q6UXD1 HRCT1 0.62303
3 Q8NEC5 CATSPER1 0.61951 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
...
4 P04196 HRG 0.58761 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
5 P49908 SELENOP 0.58386 anatomical structure development GO:0048856
growth GO:0040007
reproduction GO:0000003
...
6 Q6NTF9 RHBDD2 0.54385 catabolic process GO:0009056
response to stress GO:0006950
signal transduction GO:0007165
7 Q92504 SLC39A7 0.53328 homeostatic process GO:0042592
transmembrane transport GO:0055085
transport GO:0006810
8 Q8NEW0 SLC30A7 0.52287 homeostatic process GO:0042592
transport GO:0006810
9 Q9NRY7 PLSCR2 0.49583 membrane organization GO:0061024
plasma membrane organization GO:0007009
transport GO:0006810
10 Q969G9 NKD1 0.49024 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      MSSSGYPPNQGAFSTEQSHYPPHSVKYTFPSTHHQQDPAFGGKHEAPSSPILGQPCGDDQNASPSKLSKEELIECMDRVDREIAKVEQQILKLKKKQVKV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DD......DD.............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
RICH_[PY]:                    YPPnqgafsteqshYPP                                                                              
RICH_[H]:                                  HyppHsvkytfpstHH                                                                  
RICH_[GP]:                                                    PafGGkheaPssPilGqPcG                                           
RICH_[HP]:                                 HyPPHsvkytfPstHHqqdP                                                              
RICH_[HY]:                                 HYppHsvkYtfpstHH                                                                  
RICH_fLPS_[H]:                             HyppHsvkytfpstHH                                                                  
RICH_MOBI_[H]:                             HyppHsvkytfpstHH                                                                  
RICH_MOBI_[Y]:                YppnqgafsteqshY                                                                                
RICH_MOBI_[FY]:                      FsteqshYpphsvkYtF                                                                       
RICH_MOBI_[HY]:                            HYppHsvkYtfpstHH                                                                  
RICH_fLPS_MOBI_[H]:                    teqsHyppHsvkytfpstHH                                                                  

                                           
AA:                      FV
STMI:                      
DO_DISOPRED3:            ..
DO_IUPRED2A:             ..
DO_SPOTD:                DD
CONSENSUS:               ..
CONSENSUS_MOBI:          ..