Q9H7X2 CA115_HUMAN

Gene name: C1orf115
Protein name: Uncharacterized protein C1orf115

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NUQ3 TXLNG 0.733 anatomical structure development GO:0048856
cell cycle GO:0007049
2 Q8N3Y1 FBXW8 0.73098 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
3 Q96PV4 PNMA5 0.71634 cell death GO:0008219
4 Q9H7J1 PPP1R3E 0.70702 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
generation of precursor metabolites and energy GO:0006091
...
5 Q8N6I1 EID2 0.7055 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 Q9UD57 NKX1-2 0.70492 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 Q8N5A5 ZGPAT 0.70152 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
8 O95622 ADCY5 0.70031 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
9 P33908 MAN1A1 0.68168 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
10 O60347 TBC1D12 0.67429 catabolic process GO:0009056
cellular component assembly GO:0022607
protein transport GO:0015031
...

                                           20                  40                  60                  80                 100
AA:                      MTVGARLRSKAESSLLRRGPRGRGRTEGDEEAAAILEHLEYADEAEAAAESGTSAADERGPGTRGARRVHFALLPERYEPLEEPAPSEQPRKRYRRKLKK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD.DDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDD...................................
DO_IUPRED2A:             DDDDD.DDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDD..DD............DDDDDDDDDDDDDDDDDD...
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDD.......
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDD.......
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............DDDDDDDDDDDDDDDDDDDDD..................................
RICH_[AE]:                                                        AdEAEAAAEsgtsAAdE                                          
RICH_[AG]:                                                             AAAesGtsAAderGpGtrGA                                  
RICH_[A]:                                                         AdeAeAAAesgtsAA                                            
RICH_[G]:                                  GprGrGrteG                                                                        
RICH_[R]:                     RlRskaessllRRgpRgRgR                                                                           
RICH_[GR]:                               RRGpRGRGRteG                                                                        
RICH_fLPS_[A]:                                                   yAdeAeAAAesgtsAAderg                                        
RICH_fLPS_[R]:                          lRRgpRgRgR                                                                           
RICH_MOBI_[AG]:                                                        AAAesGtsAAderGpGtrGA                                  
RICH_MOBI_[A]:                                                         AAAesgtsAAdergpgtrgA                                  
RICH_MOBI_[G]:                             GprGrGrteG                                                                        
RICH_MOBI_[R]:                RlRskaessllRRgpRgRgR                                                                           
RICH_MOBI_[EG]:                     EssllrrGprGrGrtEGdEE                                                                     
RICH_MOBI_[ER]:                     EssllRRgpRgRgRtEgdEE                                                                     
RICH_MOBI_[GR]:                          RRGpRGRGRteG                                                                        
RICH_fLPS_MOBI_[R]:                     lRRgpRgRgR                                                                           

                                          120                 140                  
AA:                      YGKNVGKVIIKGCRYVVIGLQGFAAAYSAPFAVATSVVSFVR
STMI:                                   MMMMMMMMMMMMMMMMMMMMMMM    
DO_DISOPRED3:            ..........................................
DO_IUPRED2A:             ..........................................
DO_SPOTD:                ........................................DD
CONSENSUS:               ...............                       ....
CONSENSUS_MOBI:          ...............                       ....