Q9HCN2 TPIP1_HUMAN
Gene name: TP53AIP1
Protein name: p53-regulated apoptosis-inducing protein 1
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96HE8 | TMEM80 | 0.72062 | cellular component assembly GO:0022607 |
| 2 | Q9Y5Y4 | PTGDR2 | 0.7049 | cell population proliferation GO:0008283 immune system process GO:0002376 reproduction GO:0000003 ... |
| 3 | P0DP75 | MED14OS | 0.70442 | |
| 4 | P83369 | LSM11 | 0.69518 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q9UIW0 | VAX2 | 0.69287 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q86X51 | EZHIP | 0.68279 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 |
| 7 | Q96BM1 | ANKRD9 | 0.6794 | cellular protein modification process GO:0006464 |
| 8 | A8MYJ7 | TTC34 | 0.67485 | |
| 9 | Q86X59 | LINC02875 | 0.67092 | |
| 10 | A8MXT2 | MAGEB17 | 0.66894 |
20 40 60 80 100 AA: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: D.D.D......DD.....DDDDD.DDDDDDDDDDDDDDDDDDDDDDD..................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... RICH_[AR]: AsfRsAqAscsgARRqglgR RICH_[AS]: SSSeASfrSAqAScSgA RICH_[G]: GarrqGlGrG RICH_[R]: RsaqascsgaRRqglgR RICH_[S]: SSSeaSfrSaqaScS RICH_[GR]: RsaqascsGaRRqGlGRG RICH_MOBI_[AR]: AsfRsAqAscsgARRqglgR RICH_MOBI_[AS]: SSSeASfrSAqAScSgA RICH_MOBI_[G]: GarrqGlGrG RICH_MOBI_[R]: RsaqascsgaRRqglgR RICH_MOBI_[S]: SSSeaSfrSaqaScS RICH_MOBI_[GR]: RsaqascsGaRRqGlGRG
120 AA: LRDRPLGSAFELSYDQKKAPLRLQ STMI: DO_DISOPRED3: ........................ DO_IUPRED2A: ........................ DO_SPOTD: ..............DDDDDDDDDD CONSENSUS: ........................ CONSENSUS_MOBI: ........................