Q9NP95 FGF20_HUMAN
Gene name: FGF20
Protein name: Fibroblast growth factor 20
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- growth GO:0040007
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NPI5 | NMRK2 | 0.65955 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | B3EWF7 | EPM2A | 0.63675 | catabolic process GO:0009056 signal transduction GO:0007165 |
| 3 | P39905 | GDNF | 0.63257 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | Q9UIL4 | KIF25 | 0.61558 | catabolic process GO:0009056 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 5 | Q5T8R8 | DOCK8-AS1 | 0.61427 | |
| 6 | Q96T55 | KCNK16 | 0.61146 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | P0DP75 | MED14OS | 0.61018 | |
| 8 | Q9Y399 | MRPS2 | 0.6099 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | B2RXF0 | TMEM229A | 0.60847 | |
| 10 | P83369 | LSM11 | 0.60617 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEF STMI: DO_DISOPRED3: DDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. DO_IUPRED2A: ........................D......D...DDDDDDDDDDDDDD................................................... DO_SPOTD: DDDDD...........D...D..DDDDDD..DDDDDDDDDDDDDDDDDDDDDDDD............................................. CONSENSUS: DDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................. RICH_[PR]: PPageRPPllgeRRsaaeR RICH_[AG]: GerrsAAersArGGpGA RICH_[AR]: AgeRppllgeRRsAAeRsAR RICH_[R]: RppllgeRRsaaeRsaR RICH_[GR]: GeRRsaaeRsaRGGpG RICH_[LP]: LLPPagerPPLL RICH_MOBI_[AR]: AgeRppllgeRRsAAeRsAR RICH_MOBI_[G]: GGflGGleGlGqqvG RICH_MOBI_[L]: LaevggfLggLegL LLppagerppLL RICH_MOBI_[R]: RppllgeRRsaaeRsaR RICH_MOBI_[FG]: GGFlGGleGlGqqvGshF RICH_MOBI_[FL]: FLggLegLgqqvgshFLL RICH_MOBI_[GL]: LaevGGfLGGLeGLGqqvGshfL RICH_fLPS_MOBI_[G]: plaevGGflGGleGlGqqvG
120 140 160 180 200 AA: ISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ...........................................................................D.DDD.D.D................ DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: PELYKDLLMYT STMI: DO_DISOPRED3: ..DD.D...DD DO_IUPRED2A: ........... DO_SPOTD: .......DDDD CONSENSUS: .........DD CONSENSUS_MOBI: ........DDD