Q9NPL8 TIDC1_HUMAN
Gene name: TIMMDC1
Protein name: Complex I assembly factor TIMMDC1, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P36544 | CHRNA7 | 0.55649 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 2 | Q92839 | HAS1 | 0.55649 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell adhesion GO:0007155 ... |
| 3 | Q495A1 | TIGIT | 0.53056 | cell adhesion GO:0007155 immune system process GO:0002376 |
| 4 | Q86TJ5 | ZNF554 | 0.48646 | |
| 5 | Q9NVF9 | ETNK2 | 0.48517 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 embryo development GO:0009790 ... |
| 6 | P51149 | RAB7A | 0.46949 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 7 | Q9UBJ2 | ABCD2 | 0.46246 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | P0CW00 | TSPY8 | 0.45932 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 9 | Q99633 | PRPF18 | 0.44983 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q14145 | KEAP1 | 0.44827 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHA STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................... CONSENSUS_MOBI: ............................................................................... RICH_[AC]: AprsflCrAlClfprvfAAeAvtA RICH_[AE]: AAEAvtAdsEvlEE RICH_[F]: FlcralclFprvF RICH_[CF]: FlCralClFprvF RICH_[CP]: PPPaPrsflCralClfP
120 140 160 180 200 AA: KQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGT STMI: MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................... ..... ... CONSENSUS_MOBI: .................................... ..... ...
220 240 260 280 AA: PVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD STMI: MMMMMMMMM DO_DISOPRED3: ...................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...................D...........................DDDDDDDDDDDD.D.D.DDDD........D..DDDDDD DO_SPOTD: ..................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................................ RICH_[E]: EsslqEdEpE RICH_[EL]: LqEdEpEndakkiEaLLnL