Q9NQE9 HINT3_HUMAN
Gene name: HINT3
Protein name: Histidine triad nucleotide-binding protein 3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q2VPJ9 | LRRC75B | 0.61707 | |
2 | P54727 | RAD23B | 0.58302 |
anatomical structure development
GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
3 | P53396 | ACLY | 0.55644 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
4 | Q9BR76 | CORO1B | 0.54858 |
anatomical structure development
GO:0048856 cell morphogenesis GO:0000902 cellular component assembly GO:0022607 ... |
5 | Q6NUQ1 | RINT1 | 0.53264 |
cell cycle
GO:0007049 mitotic cell cycle GO:0000278 protein transport GO:0015031 ... |
6 | Q8N1N2 | DYNAP | 0.52089 |
cell death
GO:0008219 cell population proliferation GO:0008283 cellular protein modification process GO:0006464 |
7 | P51149 | RAB7A | 0.51834 |
biological process involved in symbiotic interaction
GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
8 | Q8N377 | n/a | 0.49897 | |
9 | Q8N9M1 | C19orf47 | 0.48875 | |
10 | P42345 | MTOR | 0.48486 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
20 40 60 80 100
AA: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLR
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
DO_IUPRED2A: DDDDD.......DD...............DDDD...D...............................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................
RICH_[AC]: ApdCeAsAtAettvssvgtC
RICH_[AT]: ApdceAsATAeTTvssvgT
RICH_[A]: AglApdceAsAtA
RICH_[T]: TaeTTvssvgT
RICH_[CT]: CeasaTaeTTvssvgTC
RICH_MOBI_[AC]: ApdCeAsAtAettvssvgtC
RICH_MOBI_[AT]: ApdceAsATAeTTvssvgT
RICH_MOBI_[A]: AglApdceAsAtA
RICH_MOBI_[T]: TaeTTvssvgT
RICH_MOBI_[CT]: CeasaTaeTTvssvgTC
RICH_MOBI_[TV]: TaeTTVssVgT
120 140 160 180
AA: KDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT
STMI:
DO_DISOPRED3: ..................................................................................
DO_IUPRED2A: ..................................................................................
DO_SPOTD: ..................................................................................
CONSENSUS: ..................................................................................
CONSENSUS_MOBI: ..................................................................................