Q9NQE9 HINT3_HUMAN
Gene name: HINT3
Protein name: Histidine triad nucleotide-binding protein 3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q2VPJ9 | LRRC75B | 0.61707 | |
2 | P54727 | RAD23B | 0.58302 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
3 | P53396 | ACLY | 0.55644 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
4 | Q9BR76 | CORO1B | 0.54858 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 cellular component assembly GO:0022607 ... |
5 | Q6NUQ1 | RINT1 | 0.53264 | cell cycle GO:0007049 mitotic cell cycle GO:0000278 protein transport GO:0015031 ... |
6 | Q8N1N2 | DYNAP | 0.52089 | cell death GO:0008219 cell population proliferation GO:0008283 cellular protein modification process GO:0006464 |
7 | P51149 | RAB7A | 0.51834 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
8 | Q8N377 | n/a | 0.49897 | |
9 | Q8N9M1 | C19orf47 | 0.48875 | |
10 | P42345 | MTOR | 0.48486 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
20 40 60 80 100 AA: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ DO_IUPRED2A: DDDDD.......DD...............DDDD...D............................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... RICH_[AC]: ApdCeAsAtAettvssvgtC RICH_[AT]: ApdceAsATAeTTvssvgT RICH_[A]: AglApdceAsAtA RICH_[T]: TaeTTvssvgT RICH_[CT]: CeasaTaeTTvssvgTC RICH_MOBI_[AC]: ApdCeAsAtAettvssvgtC RICH_MOBI_[AT]: ApdceAsATAeTTvssvgT RICH_MOBI_[A]: AglApdceAsAtA RICH_MOBI_[T]: TaeTTvssvgT RICH_MOBI_[CT]: CeasaTaeTTvssvgTC RICH_MOBI_[TV]: TaeTTVssVgT
120 140 160 180 AA: KDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT STMI: DO_DISOPRED3: .................................................................................. DO_IUPRED2A: .................................................................................. DO_SPOTD: .................................................................................. CONSENSUS: .................................................................................. CONSENSUS_MOBI: ..................................................................................