Q9NR00 TCIM_HUMAN

Gene name: TCIM
Protein name: Transcriptional and immune response regulator

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96LP2 FAM81B 0.6686
2 Q9Y6U3 SCIN 0.63762
3 P78345 RPP38 0.63087 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
4 O95470 SGPL1 0.59612 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q9Y490 TLN1 0.58933 biological process involved in symbiotic interaction GO:0044403
cell adhesion GO:0007155
cell junction organization GO:0034330
...
6 Q9Y5H5 PCDHA9 0.57647 cell adhesion GO:0007155
7 Q709C8 VPS13C 0.57358 catabolic process GO:0009056
protein targeting GO:0006605
protein transport GO:0015031
...
8 Q9UN73 PCDHA6 0.57085 anatomical structure development GO:0048856
cell adhesion GO:0007155
9 Q9Y5H6 PCDHA8 0.56952 anatomical structure development GO:0048856
cell adhesion GO:0007155
10 Q96N22 ZNF681 0.56885 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................D.D.
DO_IUPRED2A:             ..................................................DDDDD.........................D...................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................DDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................DDD.
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[AI]:                                                                     AeerAkIIfAIdqdveektrAlmA                 
RICH_MOBI_[K]:                                                                    KKaeeraKiifaidqdveeKtralmalKKrtKdKlfqflKlrK
RICH_MOBI_[L]:                                                                                           LmaLkkrtkdkLfqfLkL  
RICH_MOBI_[EI]:                                                                      EErakIIfaIdqdvEE                        
RICH_MOBI_[EK]:                                                                   KKaEEraKiifaidqdvEEK                       
RICH_MOBI_[FI]:                               IhgyhFdtasrkkavgnIF           FrnsgdkkaeerakIIFaI                              
RICH_MOBI_[FK]:                                                                                      KtralmalKKrtKdKlFqFlKlrK
RICH_MOBI_[FL]:                                                                                          LmaLkkrtkdkLFqFLkL  
RICH_MOBI_[IK]:                                                                   KKaeeraKIIfaIdqdveeK                       
RICH_MOBI_[KL]:                                                                                      KtraLmaLKKrtKdKLfqfLKLrK
RICH_fLPS_MOBI_[I]:                                                                  eerakIIfaI                              
RICH_fLPS_MOBI_[K]:                                                                                          KKrtKdKlfqflKlrK

                                       
AA:                      YSIKVH
STMI:                          
DO_DISOPRED3:            .....D
DO_IUPRED2A:             ......
DO_SPOTD:                DDDDDD
CONSENSUS:               .....D
CONSENSUS_MOBI:          DDDDDD
RICH_MOBI_[K]:           ysiK  
RICH_MOBI_[FK]:          ysiK  
RICH_fLPS_MOBI_[K]:      ysiK