Q9NRG0 CHRC1_HUMAN

Gene name: CHRAC1
Protein name: Chromatin accessibility complex protein 1

List of terms from Generic GO subset, which this protein is a part of:
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5H9I0 TFDP3 0.83771 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
2 Q9P287 BCCIP 0.82404 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
3 O43847 NRDC 0.80413 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
4 O60763 USO1 0.80255 cellular component assembly GO:0022607
membrane organization GO:0061024
protein transport GO:0015031
...
5 P07237 P4HB 0.79925 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell adhesion GO:0007155
...
6 A1YPR0 ZBTB7C 0.76631 biosynthetic process GO:0009058
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
7 P13667 PDIA4 0.76501 homeostatic process GO:0042592
protein folding GO:0006457
protein transport GO:0015031
...
8 Q96RY7 IFT140 0.75444 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
9 Q5SVQ8 ZBTB41 0.7513
10 Q9NU22 MDN1 0.74568 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
protein-containing complex assembly GO:0065003
...

                                           20                  40                  60                  80                 100
AA:                      MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDD......................................................................................
DO_IUPRED2A:             ..........................................................................DD........................
DO_SPOTD:                DDDDDDDDDDDDDDD.....................................................................................
CONSENSUS:               DDDDDDDDDDDDDD......................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120         
AA:                      SKYLKMLKEEKREEDEENDNDNESDHDEADS
STMI:                                                   
DO_DISOPRED3:            .........DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ........DDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ........DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........DDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                              DeenDnDnesDhDeaD 
RICH_[E]:                        EEkrEEdEEndndnEsdhdE   
RICH_[DE]:                       EEkrEEDEEnDnDnEsDhDEaD 
RICH_[DN]:                             DeeNDNDNesDhDeaD 
RICH_[EN]:                       EEkrEEdEENdNdNEsdhdE   
RICH_fLPS_[DE]:                  EEkrEEDEEnDnDnEsDhDEaD 
RICH_fLPS_[D]:                         DeenDnDnesDhDeaD 
RICH_fLPS_[E]:                   EEkrEEdEEndndnEsdhdE   
RICH_MOBI_[D]:                         DeenDnDnesDhDeaD 
RICH_MOBI_[E]:                   EEkrEEdEEndndnEsdhdE   
RICH_MOBI_[DE]:                  EEkrEEDEEnDnDnEsDhDEaD 
RICH_MOBI_[DN]:                        DeeNDNDNesDhDeaD 
RICH_MOBI_[EN]:                  EEkrEEdEENdNdNEsdhdE   
RICH_fLPS_MOBI_[DE]:             EEkrEEDEEnDnDnEsDhDEaD 
RICH_fLPS_MOBI_[D]:                    DeenDnDnesDhDeaD 
RICH_fLPS_MOBI_[E]:              EEkrEEdEEndndnEsdhdE