Q9NS69 TOM22_HUMAN

Gene name: TOMM22
Protein name: Mitochondrial import receptor subunit TOM22 homolog

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell death GO:0008219
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O75155 CAND2 0.76972 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 Q9NY61 AATF 0.76218 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
3 Q9Y5Q8 GTF3C5 0.75788 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q9H6Y2 WDR55 0.75753 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
5 Q8IWA0 WDR75 0.75605 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
6 Q3KNV8 PCGF3 0.74433 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
chromosome organization GO:0051276
7 Q96I76 GPATCH3 0.74192 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
8 Q8IYE0 CCDC146 0.73862
9 O43719 HTATSF1 0.73386 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
10 O00148 DDX39A 0.732 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
nucleocytoplasmic transport GO:0006913
...

                                           20                  40                  60                  80                 100
AA:                      MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV
STMI:                                                                                                       MMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................
DO_IUPRED2A:             ....DDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......D....D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................                 
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................                 
RICH_[D]:                                DellpkgDaekpeeeleeDDDeelD                                                           
RICH_[E]:                           EpqspdEllpkgdaEkpEEElEEdddEEldE                                                          
RICH_[DE]:                               DEllpkgDaEkpEEElEEDDDEElDE                                                          
RICH_[EP]:                          EPqsPdEllPkgdaEkPEEE                                                                     
RICH_MOBI_[D]:                           DellpkgDaekpeeeleeDDDeelD                                                           
RICH_MOBI_[E]:                      EpqspdEllpkgdaEkpEEElEEdddEEldE                                                          
RICH_MOBI_[DE]:                          DEllpkgDaEkpEEElEEDDDEElDE                                                          
RICH_MOBI_[EL]:                           ELLpkgdaEkpEEELE                                                                   
RICH_fLPS_MOBI_[A]:      mAAAvAAAgAgepqspdell                                                                                
RICH_fLPS_MOBI_[E]:                            gdaEkpEEElEEdddEEldE                                                          

                                          120                 140                  
AA:                      FETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
STMI:                    MMM                                       
DO_DISOPRED3:            .....................DDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .......D...DDDDDDDDD.DD......DDDD.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                  ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:             .......................................
RICH_[G]:                                     GpntGlsGGmpGalpslpG  
RICH_[GL]:                            LqqrqiLLGpntGLsGGmpG         
RICH_[GP]:                                    GPntGlsGGmPGalPslPG  
RICH_[GQ]:                         QQQlQQrQillGpntGlsGG            
RICH_[LP]:                                  LLgPntgLsggmPgaLPsLP   
RICH_[LQ]:                        QQQQLQQrQiLLgpntgL               
RICH_fLPS_[Q]:                  meQQQQlQQrQillgpntgl