List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- circulatory system process GO:0003013
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                   
AA:                      MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
STMI:                                                                                                     
DO_DISOPRED3:            DDDDDDD....................................................................D.DDDD
DO_IUPRED2A:             DDDDDDDDDDDDD......................................DDDDDDDDD..DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDD.............................................DDDDDDDDDDDD.....DDDDDDDDD
CONSENSUS:               DDDDDDDDDD.............................................DDDDDDDDDDDD.....DDDDDDDDD
CONSENSUS_MOBI:          DDDDDDD...............................................DDDDD...................DDD